Pfam domain
Pfam family: MBD (PF01429.21)
Uniprot AC: Q9UBB5
RecName: Methyl-CpG-binding domain protein 2
Begin-End: 148-215
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFD
FRTGKMMP
Structures of the domain Q9UBB5 148-215
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cnp X-ray 2.1 A 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1t X-ray 1.84 D 149-214  H-Bb S-Mj L-Bb L-Mj 
6c1t X-ray 1.84 A 148-214  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1u X-ray 2.3 E 147-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1u X-ray 2.3 F 147-214  S-Bb S-Mj L-Bb L-Mj 
6c1u X-ray 2.3 A 147-214  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1u X-ray 2.3 B 148-215  S-Bb S-Mj L-Bb L-Mj 
6c1a X-ray 2.05 E 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1a X-ray 2.05 F 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1a X-ray 2.05 A 147-214  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1a X-ray 2.05 B 148-214  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1v X-ray 2.3 F 148-215  H-Bb S-Mj L-Bb L-Mj 
6c1v X-ray 2.3 E 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c1v X-ray 2.3 B 147-214  H-Bb S-Mj L-Bb L-Mj 
6c1v X-ray 2.3 A 148-215  S-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 P 148-215  S-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 M 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 J 148-214  H-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 G 148-215  S-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 D 148-215  S-Bb S-Mj L-Bb L-Mj 
6c2f X-ray 2.65 A 147-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6cnq X-ray 2.15 B 148-215  H-Bb S-Bb S-Mj L-Bb L-Mj 
6cnq X-ray 2.15 A 148-215  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text