Pfam domain
Pfam family: ORC3_N (PF07034.13)
Uniprot AC: Q9UBD5
RecName: Origin recognition complex subunit 3
Begin-End: 18-344
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFL
QKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQ
AKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDP
KMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPI
IIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYH
DFSVQNFIKGLQLSLLEHFYSQPLSVL
Structures of the domain Q9UBD5 18-344
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 C 18-344  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text