Pfam domain
Pfam family: SPRY (PF00622.30)
Uniprot AC: Q9UBL3
RecName: Set1/Ash2 histone methyltransferase complex subunit ASH2
Begin-End: 420-494
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG
YGQGDVLGFYINLPE
Structures of the domain Q9UBL3 420-494
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kix X-ray 4.1 T 326-486 None
6kiu X-ray 3.2 T 326-486 None
6pwv X-ray 6.2 D 326-404 None
6kiz X-ray 4.5 T 326-486 None
6kiw X-ray 4 T 326-486 None
6kiv X-ray 4 T 326-486 None


© NPIDB team 2003 - 2021

text