Pfam domain
Pfam family: IMS_HHH (PF11798.10)
Uniprot AC: Q9UBT6
RecName: DNA polymerase kappa
Begin-End: 339-370
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
RQAVMDFIKDLPIRKVSGIGKVTEKMLKALGI
Structures of the domain Q9UBT6 339-370
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2w7o X-ray 3.16 A 339-370  H-Bb L-Bb 
2w7o X-ray 3.16 B 339-370  H-Bb L-Bb 
6brx X-ray 2.8 A 339-370  H-Bb L-Bb 
6brx X-ray 2.8 B 339-370  H-Bb L-Bb 
3pzp X-ray 3.34 B 339-370  H-Bb L-Bb 
3pzp X-ray 3.34 A 339-370  H-Bb L-Bb 
5w2c X-ray 2.5 B 339-370  H-Bb L-Bb 
5w2c X-ray 2.5 A 339-370  H-Bb L-Bb 
3in5 X-ray 3.2 B 339-370  H-Bb L-Bb 
3in5 X-ray 3.2 A 339-370  H-Bb L-Bb 
2w7p X-ray 3.71 A 339-370  H-Bb L-Bb 
2w7p X-ray 3.71 B 339-370  H-Bb L-Bb 
5t14 X-ray 3 B 339-370  H-Bb L-Bb 
5t14 X-ray 3 A 339-370  H-Bb L-Bb 
5w2a X-ray 2.9 B 339-370  H-Bb L-Bb 
5w2a X-ray 2.9 A 339-370  H-Bb L-Bb 
4u6p X-ray 2.59 B 339-370  H-Bb L-Bb 
4u6p X-ray 2.59 A 339-370  H-Bb L-Bb 
2oh2 X-ray 3.05 B 339-370  H-Bb L-Bb 
2oh2 X-ray 3.05 A 339-370  H-Bb L-Bb 
6cst X-ray 2 A 339-370  H-Bb L-Bb 
6cst X-ray 2 B 339-370  H-Bb L-Bb 
6bs1 X-ray 3.15 A 339-370  H-Bb L-Bb 
6bs1 X-ray 3.15 B 339-370  H-Bb L-Bb 
4u7c X-ray 2.8 A 339-370  H-Bb L-Bb 
4u7c X-ray 2.8 B 339-370  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text