Pfam domain
Pfam family: IMS_C (PF11799.7)
Uniprot AC: Q9UBT6
RecName: DNA polymerase kappa
Begin-End: 407-517
Organism: Homo sapiens
Interaction Mode:  S-Bb S-Mj L-Bb L-Mj 

Sequence:
LTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFE
VKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFP
Structures of the domain Q9UBT6 407-517
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2w7o X-ray 3.16 A 411-516  S-Bb L-Bb 
2w7o X-ray 3.16 B 411-516 None
3pzp X-ray 3.34 B 411-515  S-Bb L-Bb 
3pzp X-ray 3.34 A 411-516 None
5w2c X-ray 2.5 A 411-515 None
5w2c X-ray 2.5 B 411-515 None
3in5 X-ray 3.2 B 411-515  S-Bb L-Bb 
3in5 X-ray 3.2 A 411-515 None
2w7p X-ray 3.71 B 411-516 None
2w7p X-ray 3.71 A 411-516 None
5t14 X-ray 3 A 411-515 None
5t14 X-ray 3 B 411-515 None
4u6p X-ray 2.59 A 411-515 None
4u6p X-ray 2.59 B 411-515 None
4u7c X-ray 2.8 A 411-515 None
4u7c X-ray 2.8 B 411-515 None
5w2a X-ray 2.9 A 411-515 None
5w2a X-ray 2.9 B 411-515 None
2oh2 X-ray 3.05 A 411-515  S-Bb S-Mj L-Bb 
2oh2 X-ray 3.05 B 411-515  S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text