Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q9UBX2
RecName: Double homeobox protein 4
Begin-End: 20-76
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLR
Structures of the domain Q9UBX2 20-76
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zfz X-ray 1.9 A 20-76  H-Bb H-Mj L-Bb L-Mn 
5zfw X-ray 2.1 A 20-76  H-Bb H-Mj L-Bb L-Mn 
5zfy X-ray 2.3 A 20-76  H-Bb H-Mj L-Bb L-Mn 
5z6z X-ray 2.3 A 20-76  H-Bb H-Mj L-Bb L-Mn 
6u81 X-ray 2.34 A 20-76  H-Bb H-Mj L-Bb 
6u82 X-ray 3.21 A 20-76  H-Bb H-Mj L-Bb L-Mn 
6u82 X-ray 3.21 D 20-76  H-Bb H-Mj L-Bb L-Mn 
6e8c X-ray 2.12 A 20-76  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text