Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q9UBX2
RecName: Double homeobox protein 4
Begin-End: 98-149
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARH
Structures of the domain Q9UBX2 98-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zfz X-ray 1.9 A 95-149  H-Bb H-Mj L-Bb L-Mn 
5z2t X-ray 2.62 D 9-60  H-Bb H-Mj 
5z2t X-ray 2.62 C 9-60  H-Bb H-Mj 
5zfw X-ray 2.1 A 95-149  H-Bb H-Mj L-Bb L-Mn 
5zfy X-ray 2.3 A 95-149  H-Bb H-Mj L-Bb L-Mn 
5z6z X-ray 2.3 A 95-149  H-Bb H-Mj L-Bb L-Mj L-Mn 
6a8r X-ray 1.6 B 2-56 None
6a8r X-ray 1.6 A 2-56  H-Bb H-Mj L-Bb L-Mn 
6u81 X-ray 2.34 A 95-149  H-Bb H-Mj L-Bb L-Mn 
6u82 X-ray 3.21 A 95-149  H-Bb H-Mj L-Bb L-Mj 
6u82 X-ray 3.21 D 95-149  H-Bb H-Mj L-Bb 
6e8c X-ray 2.12 A 95-149  H-Bb H-Mj L-Bb L-Mj L-Mn 
6dfy X-ray 2.62 C 9-60  H-Bb H-Mj 
6dfy X-ray 2.62 D 10-60  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text