Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: Q9UHN1
RecName: DNA polymerase subunit gamma-2, mitochondrial
Begin-End: 379-478
Organism: Homo sapiens
Interaction Mode:   

Sequence:
APIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSIL
FTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKY
Structures of the domain Q9UHN1 379-478
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ztz X-ray 3.44 C 392-477 None
4ztz X-ray 3.44 B 392-477 None
5c53 X-ray 3.57 C 392-477 None
5c53 X-ray 3.57 B 392-477 None
5c51 X-ray 3.43 C 392-477 None
5c51 X-ray 3.43 B 392-477 None
5c52 X-ray 3.64 C 392-477 None
5c52 X-ray 3.64 B 392-477 None


© NPIDB team 2003 - 2019

text