Pfam domain
Pfam family: MBD (PF01429.21)
Uniprot AC: Q9UIS9
RecName: Methyl-CpG-binding domain protein 1
Begin-End: 1-75
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLT
LFDFKQGILCYPAPK
Structures of the domain Q9UIS9 1-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ig4 NMR A 1-71  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text