Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9UK45
RecName: U6 snRNA-associated Sm-like protein LSm7
Begin-End: 13-86
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLG
LVVCRGTSVVLICP
Structures of the domain Q9UK45 13-86
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 7 14-86 None
5o9z X-ray 4.5 t 5-86 None


© NPIDB team 2003 - 2019

text