Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: Q9UKV8
RecName: Protein argonaute-2
Begin-End: 517-818
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNN
ILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQ
EIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEK
DYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGI
QGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYH
LV
Structures of the domain Q9UKV8 517-818
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4f3t X-ray 2.25 A 518-817 None
4w5t X-ray 2.5 A 518-817 None
4z4c X-ray 2.3 A 518-817 None
4z4h X-ray 2.5 A 518-817 None
4z4g X-ray 2.7 A 518-817 None
6cbd X-ray 2.2 A 518-817 None
4z4d X-ray 1.6 A 518-817 None
4w5r X-ray 2.5 A 518-817 None
4ola X-ray 2.3 A 518-839 None
4olb X-ray 2.9 A 518-817 None
4w5o X-ray 1.8 A 518-817 None
5wea X-ray 3.12 A 518-839 None
4z4f X-ray 2.8 A 518-817 None
5ki6 X-ray 2.15 A 518-839 None
5t7b X-ray 2.53 A 518-817 None
5js1 X-ray 2.5 A 518-817 None
4z4i X-ray 2.8 A 518-817 None
4w5q X-ray 3.1 A 518-817 None
4z4e X-ray 1.8 A 518-817 None
4w5n X-ray 2.9 A 518-839 None


© NPIDB team 2003 - 2020

text