Pfam domain
Pfam family: PAZ (PF02170.21)
Uniprot AC: Q9UL18
RecName: Protein argonaute-1
Begin-End: 229-349
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPAS
HQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ
R
Structures of the domain Q9UL18 229-349
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1si2 X-ray 2.6 A 238-349 None
1si3 X-ray 2.6 A 242-349 None


© NPIDB team 2003 - 2019

text