Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: Q9UL18
RecName: Protein argonaute-1
Begin-End: 515-816
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINN
ILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQ
EIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEK
DYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGI
QGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYH
LV
Structures of the domain Q9UL18 515-816
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w6v X-ray 2.83 A 515-815 None
4krf X-ray 2.1 A 515-815 None
4kre X-ray 1.75 A 515-815 None
4kxt X-ray 2.29 A 515-815 None


© NPIDB team 2003 - 2020

text