Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9ULG1
RecName: Chromatin-remodeling ATPase INO80
Begin-End: 1101-1214
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMV
ADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTVDQQAMDRAHRLG
Structures of the domain Q9ULG1 1101-1214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6etx X-ray 4.8 G 1106-1214 None


© NPIDB team 2003 - 2019

text