Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9UMR2
RecName: ATP-dependent RNA helicase DDX19B
Begin-End: 319-434
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIER
FREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFG
Structures of the domain Q9UMR2 319-434
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3g0h X-ray 2.7 A 320-434 None
3fht X-ray 2.2 B 320-434 None
3fht X-ray 2.2 A 320-434 None


© NPIDB team 2003 - 2019

text