Pfam domain
Pfam family: Cdd1 (PF11731.10)
Uniprot AC: Q9UNA4
RecName: DNA polymerase iota
Begin-End: 225-278
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
ASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEAL
Structures of the domain Q9UNA4 225-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gv5 X-ray 2 D 230-283  H-Bb L-Bb 
3gv5 X-ray 2 B 230-283  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text