Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: Q9UNA4
RecName: DNA polymerase iota
Begin-End: 58-236
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 

Sequence:
VDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLV
LVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVT
VSGHVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSG
Structures of the domain Q9UNA4 58-236
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5kt6 X-ray 3.54 A 58-236  H-Bb S-Bb L-Bb 
2dpj X-ray 2.3 A 33-211  H-Bb S-Mn L-Bb 
5ulx X-ray 1.96 A 33-211  H-Bb H-Mn S-Bb L-Bb 
3epg X-ray 2.5 A 33-211  H-Bb S-Bb L-Bb 
3h4d X-ray 2.2 A 33-211  H-Bb H-Mn S-Mn L-Bb 
1t3n X-ray 2.3 A 33-211  H-Bb 
1t3n X-ray 2.3 B 453-631  H-Bb H-Mn S-Bb S-Mn L-Bb 
4fs1 X-ray 2.5 A 33-211  H-Bb S-Bb L-Bb 
2fln X-ray 2.5 A 33-211  H-Bb H-Mn S-Bb L-Bb 
3g6v X-ray 2.2 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
3epi X-ray 2.9 A 33-211  H-Bb S-Bb L-Bb 
3h4b X-ray 2.85 A 33-211  H-Bb S-Bb L-Bb 
4ebd X-ray 2.57 A 33-211  H-Bb H-Mn S-Bb L-Bb 
2fll X-ray 2.6 A 33-211  H-Bb H-Mn L-Bb 
2flp X-ray 2.4 A 33-211  H-Bb H-Mn 
3gv7 X-ray 2.2 B 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
2alz X-ray 2.5 A 33-211  H-Bb H-Mn S-Mn L-Bb 
5ulw X-ray 2.62 A 33-211  H-Bb H-Mn S-Bb L-Bb 
3gv5 X-ray 2 D 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
3gv5 X-ray 2 B 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
3osn X-ray 1.9 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
3ngd X-ray 2.8 A 33-211  H-Bb S-Bb L-Bb 
3q8r X-ray 2.45 B 33-211  H-Bb H-Mn S-Bb L-Bb L-Mn 
3q8q X-ray 2.03 B 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
3q8p X-ray 1.95 B 33-211  H-Bb H-Mn S-Bb L-Bb L-Mn 
2dpi X-ray 2.3 A 33-211  H-Bb H-Mn L-Bb 
1zet X-ray 2.3 A 33-211  H-Bb H-Mn L-Bb 
5kt7 X-ray 3.15 A 33-211  H-Bb S-Bb L-Bb 
3q8s X-ray 2.09 B 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
3h40 X-ray 2.3 A 33-211  H-Bb L-Bb 
5kt3 X-ray 2.64 A 58-236  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ebc X-ray 2.9 A 33-211  H-Bb H-Mn S-Bb L-Bb 
3gv8 X-ray 2 B 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
4fs2 X-ray 2.05 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
4eyi X-ray 2.9 B 33-211  H-Bb S-Bb 
4eyh X-ray 2.9 B 33-211  H-Bb S-Bb 
3g6x X-ray 2.08 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
5kt5 X-ray 2.8 A 58-236  H-Bb S-Bb L-Bb 
3g6y X-ray 2.1 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
4ebe X-ray 2.1 A 33-211  H-Bb H-Mn S-Bb S-Mn L-Bb 
5kt2 X-ray 2.49 A 58-236  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
5kt4 X-ray 2.78 A 58-236  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text