Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9UPY3
RecName: Endoribonuclease Dicer
Begin-End: 438-556
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAE
FRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAP
Structures of the domain Q9UPY3 438-556
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zal X-ray 4.7 A 442-554 None
5zam X-ray 5.7 A 442-554 None


© NPIDB team 2003 - 2019

text