Pfam domain
Pfam family: XPG_I (PF00867.17)
Uniprot AC: Q9UQ84
RecName: Exonuclease 1
Begin-End: 138-225
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
RSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQ
ARLGMCRQLGDVFTEEKFRYMCILSGCD
Structures of the domain Q9UQ84 138-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uzv X-ray 2.45 Z 139-225  L-Bb 
5v04 X-ray 2.65 Z 139-225 None
3qe9 X-ray 2.51 Z 139-225  L-Bb 
3qe9 X-ray 2.51 Y 139-225 None
3qea X-ray 3.1 Z 139-225 None
3qeb X-ray 3 Z 139-225 None
5v09 X-ray 2.75 Z 139-224  L-Bb 
5v05 X-ray 2.9 Z 139-225 None
5v07 X-ray 2.15 Z 139-225  L-Bb 
5v0e X-ray 2.74 Z 139-225 None
5v0d X-ray 2.63 Z 139-225 None
5v0c X-ray 2.58 Z 139-225 None
5v0b X-ray 2.63 Z 139-225 None
5v08 X-ray 2.81 Z 139-225 None
5v06 X-ray 2.75 Z 139-225 None
5v0a X-ray 2.38 Z 139-224 None


© NPIDB team 2003 - 2019

text