Pfam domain
Pfam family: XPG_N (PF00752.16)
Uniprot AC: Q9UQ84
RecName: Exonuclease 1
Begin-End: 2-99
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn 

Sequence:
GIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMK
FVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQAN
Structures of the domain Q9UQ84 2-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uzv X-ray 2.45 Z 2-98  H-Bb 
5v04 X-ray 2.65 Z 2-98  H-Bb H-Mj H-Mn 
3qe9 X-ray 2.51 Z 2-98  H-Bb H-Mj H-Mn 
3qe9 X-ray 2.51 Y 2-98 None
3qea X-ray 3.1 Z 2-98 None
3qeb X-ray 3 Z 2-98 None
5v09 X-ray 2.75 Z 2-98  H-Bb H-Mj H-Mn 
5v05 X-ray 2.9 Z 2-98  H-Bb H-Mj H-Mn 
5v07 X-ray 2.15 Z 2-98  H-Bb H-Mj H-Mn 
5v0e X-ray 2.74 Z 2-98 None
5v0d X-ray 2.63 Z 2-98 None
5v0c X-ray 2.58 Z 2-98 None
5v0b X-ray 2.63 Z 2-98 None
5v08 X-ray 2.81 Z 3-98  H-Bb H-Mj H-Mn 
5v06 X-ray 2.75 Z 2-98  H-Bb H-Mj H-Mn 
5v0a X-ray 2.38 Z 2-98 None


© NPIDB team 2003 - 2019

text