Pfam domain
Pfam family: SMC_hinge (PF06470.15)
Uniprot AC: Q9UQE7
RecName: Structural maintenance of chromosomes protein 3
Begin-End: 529-643
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFL
PLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLA
Structures of the domain Q9UQE7 529-643
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 B 529-643 None
6wg6 X-ray 3.54 L 528-642 None
6wg6 X-ray 3.54 B 528-642 None
6wg6 X-ray 3.54 J 528-642 None
6wg6 X-ray 3.54 D 528-642 None


© NPIDB team 2003 - 2021

text