Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9USZ3
RecName: Small nuclear ribonucleoprotein E
Begin-End: 18-83
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
KLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQVDAKNNKRELGRILLKGDN
ITLIQA
Structures of the domain Q9USZ3 18-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 m 110-173 None
3jb9 X-ray 3.6 H 19-82 None


© NPIDB team 2003 - 2019

text