Pfam domain
Pfam family: DNA_binding_1 (PF01035.22)
Uniprot AC: Q9UTN9
RecName: Alkyltransferase-like protein 1
Begin-End: 5-87
Organism: Schizosaccharomyces pombe
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
EFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRG
TISKRDISAGEQRQKDRLEEEGV
Structures of the domain Q9UTN9 5-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gx4 X-ray 2.7 X 5-87  H-Bb H-Mj H-Mn L-Bb 
4enm X-ray 2.84 A 5-87  H-Bb H-Mn L-Bb 
4enn X-ray 2.84 B 5-87  H-Bb H-Mn 
4enn X-ray 2.84 A 5-87  H-Bb H-Mn 
4hdu X-ray 2.85 A 5-87  H-Bb H-Mj H-Mn L-Bb 
4enj X-ray 3.1 A 5-87  H-Bb H-Mj H-Mn L-Bb 
4enk X-ray 3.04 A 5-87  H-Bb H-Mj H-Mn L-Bb 
3gyh X-ray 2.8 X 5-87  H-Bb H-Mj H-Mn L-Bb 
4hdv X-ray 2.7 A 5-87  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text