Pfam domain
Pfam family: DNA_binding_1 (PF01035.19)
Uniprot AC: Q9UTN9
RecName: Alkyltransferase-like protein 1
Begin-End: 5-87
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
EFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRG
TISKRDISAGEQRQKDRLEEEGV
Structures of the domain Q9UTN9 5-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hdu X-ray 2.85 A 5-87 None
3gx4 X-ray 2.7 X 5-87 None
4enj X-ray 3.1 A 5-87 None
4enm X-ray 2.84 A 5-87 None
3gyh X-ray 2.8 X 5-87 None
4enk X-ray 3.04 A 5-87 None
4hdv X-ray 2.7 A 5-87 None
4enn X-ray 2.84 A 5-87 None
4enn X-ray 2.84 B 5-87 None


© NPIDB team 2003 - 2019

text