Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9UUC6
RecName: Small nuclear ribonucleoprotein Sm D3
Begin-End: 6-71
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
KLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSH
IRFLIV
Structures of the domain Q9UUC6 6-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 Z 7-70 None
3jb9 X-ray 3.6 D 6-69 None


© NPIDB team 2003 - 2019

text