Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9V0Y8
RecName: Putative snRNP Sm-like protein
Begin-End: 7-72
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
DVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDN
VLAISP
Structures of the domain Q9V0Y8 7-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1m8v X-ray 2.6 N 709-772 None
1m8v X-ray 2.6 M 609-672 None
1m8v X-ray 2.6 L 509-572 None
1m8v X-ray 2.6 K 409-472 None
1m8v X-ray 2.6 J 309-372 None
1m8v X-ray 2.6 I 209-272 None
1m8v X-ray 2.6 F 609-672 None
1m8v X-ray 2.6 G 709-772 None
1m8v X-ray 2.6 H 109-172 None
1m8v X-ray 2.6 E 509-572 None
1m8v X-ray 2.6 D 409-472 None
1m8v X-ray 2.6 C 309-372 None
1m8v X-ray 2.6 B 209-272 None
1m8v X-ray 2.6 A 109-172 None


© NPIDB team 2003 - 2019

text