Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: Q9V138
RecName: Translation initiation factor 1A
Begin-End: 22-85
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
NQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGD
IVYR
Structures of the domain Q9V138 22-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 6 22-85 None


© NPIDB team 2003 - 2019

text