Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: Q9V2F3
RecName: DNA polymerase II small subunit
Begin-End: 273-338
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
VNSKRETNRGLIFEVEDKTGIVKVFLPKDSEDYREAFKVLPDAVVAFKGFYSKKGIFFAN
KFYLPD
Structures of the domain Q9V2F3 273-338
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hms X-ray 7.1 A 267-332 None


© NPIDB team 2003 - 2021

text