Pfam domain
Pfam family: DNA_pol_E_B (PF04042.18)
Uniprot AC: Q9V2F3
RecName: DNA polymerase II small subunit
Begin-End: 355-564
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
AILISDIHVGSREFCEKAFLKFLEWLNGHVESKEEEEIVSRVKYLIIAGDVVDGIGIYPG
QYSDLVIPDIFDQYEALANLLANVPEHITMFIGPGNHDAARPAIPQPEFYKEYAKPIYKL
KNAIIISNPAVIRLHGRDFLIAHGRGIEDVVSFVPGLTHHKPGLPMVELLKMRHLAPTFG
GKVPIAPDPEDLLVIEEVPDLVQMGHVHVY
Structures of the domain Q9V2F3 355-564
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t8h X-ray 3.77 A 355-564 None
6hms X-ray 7.1 A 355-564 None


© NPIDB team 2003 - 2021

text