Pfam domain
Pfam family: RRF (PF01765.18)
Uniprot AC: Q9WX76
RecName: Ribosome-recycling factor
Begin-End: 21-184
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
LEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSWDQNALKAIE
KAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKL
KKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL
Structures of the domain Q9WX76 21-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j0d X-ray 11.1 J 21-184 None
3j0e X-ray 9.9 G 21-184 None


© NPIDB team 2003 - 2019

text