Pfam domain
Pfam family: HTH_1 (PF00126.26)
Uniprot AC: Q9WXC7
RecName: LysR-type regulatory protein
Begin-End: 3-62
Organism: Cupriavidus necator
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
FRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGH
Structures of the domain Q9WXC7 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxp X-ray 2.55 B 3-61  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xxp X-ray 2.55 A 3-61  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text