Pfam domain
Pfam family: DEAD (PF00270.28)
Uniprot AC: Q9WY48
RecName: ATP-dependent DNA helicase RecG
Begin-End: 370-533
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
TNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSIL
AIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFK
NLGLVIIDEQHRFGVKQREALMNKGKMVDTLVMSATPIPRSMAL
Structures of the domain Q9WY48 370-533
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gm5 X-ray 3.24 A 375-510 None


© NPIDB team 2003 - 2019

text