Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9WY48
RecName: ATP-dependent DNA helicase RecG
Begin-End: 562-685
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
DRVNEVYEFVRQEVMRGGQAFIVYPLIEESDKLNVKSAVEMYEYLSKEVFPEFKLGLMHG
RLSQEEKDRVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRV
GRGG
Structures of the domain Q9WY48 562-685
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gm5 X-ray 3.24 A 563-685 None


© NPIDB team 2003 - 2019

text