Pfam domain
Pfam family: PUA (PF01472.19)
Uniprot AC: Q9WZW0
RecName: tRNA pseudouridine synthase B
Begin-End: 230-283
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
PRVVVHQESTKMILNGSQIHLEMLKEWDGFKKGEVVRVFNEEGRLLALAEAERN
Structures of the domain Q9WZW0 230-283
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ze2 X-ray 3 B 230-281 None


© NPIDB team 2003 - 2019

text