Pfam domain
Pfam family: PUA (PF01472.19)
Uniprot AC: Q9WZW0
RecName: tRNA pseudouridine synthase B
Begin-End: 230-300
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
PRVVVHQESTKMILNGSQIHLEMLKEWDGFKKGEVVRVFNEEGRLLALAEAERNSSFLET
LRKHERNERVL
Structures of the domain Q9WZW0 230-300
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ab4 X-ray 2.4 A 230-284 None
1ze2 X-ray 3 A 230-284 None
1r3e X-ray 2.1 A 239-314 None


© NPIDB team 2003 - 2019

text