Pfam domain
Pfam family: GatB_Yqey (PF02637.17)
Uniprot AC: Q9X100
RecName: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
Begin-End: 332-479
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
EFFEECVKVVNRPKDLSNWIMTEVLRELNERNIEITESKLTPQHFADLFKLMDEGKISIK
IAKEIFPEVFETGKMPSQIVEEKGLTQINDEKLIEELVKKAMEQNPKAVQDYKSGKKKAA
GFFVGYVMRETKGKANPELTNRIIQKLL
Structures of the domain Q9X100 332-479
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3al0 X-ray 3.37 B 332-479 None


© NPIDB team 2003 - 2019

text