Pfam domain
Pfam family: Endonuclease_5 (PF04493.13)
Uniprot AC: Q9X2H9
RecName: Endonuclease V
Begin-End: 21-215
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
NELRKKIKLTPYEGEPEYVAGVDLSFPGKEEGLAVIVVLEYPSFKILEVVSERGEITFPY
IPGLLAFREGPLFLKAWEKLRTKPDVVVFDGQGLAHPRKLGIASHMGLFIEIPTIGVAKS
RLYGTFKMPEDKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFT
LPGRRIPEPTRLAHI
Structures of the domain Q9X2H9 21-215
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2w35 X-ray 2.15 A 22-214 None
2w35 X-ray 2.15 B 22-214 None
2w35 X-ray 2.15 B 22-214 None
2w35 X-ray 2.15 A 22-214 None
2w35 X-ray 2.15 B 22-214 None
2w35 X-ray 2.15 A 22-214 None
4b20 X-ray 2.75 B 22-214 None
4b20 X-ray 2.75 A 22-214 None
4b20 X-ray 2.75 A 22-214 None
4b20 X-ray 2.75 B 22-214 None
4b20 X-ray 2.75 B 22-214 None
4b20 X-ray 2.75 A 22-214 None
2w36 X-ray 2.1 A 22-214 None
2w36 X-ray 2.1 B 22-214 None
2w36 X-ray 2.1 B 22-214 None
2w36 X-ray 2.1 A 22-214 None
2w36 X-ray 2.1 A 22-214 None
2w36 X-ray 2.1 B 22-214 None


© NPIDB team 2003 - 2019

text