Pfam domain
Pfam family: DnaB_C (PF03796.14)
Uniprot AC: Q9X4C9
RecName: Replicative DNA helicase
Begin-End: 185-440
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
GIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSA
QQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAK
CRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLS
RSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPV
GTVQLAFIKEYNKFVN
Structures of the domain Q9X4C9 185-440
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4esv X-ray 3.2 F 185-440 None
4esv X-ray 3.2 E 185-440 None
4esv X-ray 3.2 D 185-440 None
4esv X-ray 3.2 C 185-440 None
4esv X-ray 3.2 B 185-440 None
4esv X-ray 3.2 A 185-440 None
4esv X-ray 3.2 L 185-440 None
4esv X-ray 3.2 K 185-440 None
4esv X-ray 3.2 J 185-440 None
4esv X-ray 3.2 I 185-440 None
4esv X-ray 3.2 H 185-440 None
4esv X-ray 3.2 G 185-440 None


© NPIDB team 2003 - 2019

text