Pfam domain
Pfam family: TrpBP (PF02081.14)
Uniprot AC: Q9X6J6
RecName: Transcription attenuation protein MtrB
Begin-End: 5-71
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTR
HGVIESE
Structures of the domain Q9X6J6 5-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eeu X-ray 1.98 A 6-73 None
5eeu X-ray 1.98 K 7-73 None
5eeu X-ray 1.98 I 7-73 None
5eeu X-ray 1.98 J 7-73 None
5eeu X-ray 1.98 H 7-73 None
5eeu X-ray 1.98 G 7-73 None
5eeu X-ray 1.98 D 7-73 None
5eeu X-ray 1.98 E 7-73 None
5eeu X-ray 1.98 F 7-73 None
5eeu X-ray 1.98 C 6-73 None
5eeu X-ray 1.98 B 7-73 None
5eeu X-ray 1.98 T 6-73 None
5eeu X-ray 1.98 U 6-73 None
5eeu X-ray 1.98 V 6-73 None
5eeu X-ray 1.98 S 6-73 None
5eeu X-ray 1.98 R 6-73 None
5eeu X-ray 1.98 Q 6-73 None
5eeu X-ray 1.98 P 6-73 None
5eeu X-ray 1.98 N 6-73 None
5eeu X-ray 1.98 O 6-73 None
5eeu X-ray 1.98 M 6-73 None
5eeu X-ray 1.98 L 6-73 None
5ef0 X-ray 1.98 K 7-73 None
5ef0 X-ray 1.98 J 7-73 None
5ef0 X-ray 1.98 A 6-73 None
5ef0 X-ray 1.98 B 7-73 None
5ef0 X-ray 1.98 C 6-73 None
5ef0 X-ray 1.98 I 7-73 None
5ef0 X-ray 1.98 H 7-73 None
5ef0 X-ray 1.98 G 7-73 None
5ef0 X-ray 1.98 F 7-73 None
5ef0 X-ray 1.98 E 7-73 None
5ef0 X-ray 1.98 D 7-73 None
5ef0 X-ray 1.98 V 6-73 None
5ef0 X-ray 1.98 T 6-73 None
5ef0 X-ray 1.98 R 6-73 None
5ef0 X-ray 1.98 S 6-73 None
5ef0 X-ray 1.98 Q 6-73 None
5ef0 X-ray 1.98 L 6-73 None
5ef0 X-ray 1.98 M 6-73 None
5ef0 X-ray 1.98 N 6-73 None
5ef0 X-ray 1.98 O 6-73 None
5ef0 X-ray 1.98 P 6-73 None
5ef0 X-ray 1.98 U 6-73 None
1c9s X-ray 1.9 I 7-73 None
1c9s X-ray 1.9 J 7-73 None
1c9s X-ray 1.9 K 7-73 None
1c9s X-ray 1.9 G 6-73 None
1c9s X-ray 1.9 H 7-73 None
1c9s X-ray 1.9 F 7-73 None
1c9s X-ray 1.9 E 7-73 None
1c9s X-ray 1.9 D 7-73 None
1c9s X-ray 1.9 C 6-73 None
1c9s X-ray 1.9 B 7-73 None
1c9s X-ray 1.9 A 7-73 None
1c9s X-ray 1.9 S 6-73 None
1c9s X-ray 1.9 T 6-73 None
1c9s X-ray 1.9 U 6-73 None
1c9s X-ray 1.9 V 6-73 None
1c9s X-ray 1.9 Q 6-73 None
1c9s X-ray 1.9 R 6-73 None
1c9s X-ray 1.9 P 6-73 None
1c9s X-ray 1.9 M 6-73 None
1c9s X-ray 1.9 N 6-73 None
1c9s X-ray 1.9 O 6-73 None
1c9s X-ray 1.9 L 6-73 None
5eez X-ray 1.98 D 7-73 None
5eez X-ray 1.98 E 7-73 None
5eez X-ray 1.98 F 7-73 None
5eez X-ray 1.98 G 7-73 None
5eez X-ray 1.98 K 7-73 None
5eez X-ray 1.98 J 7-73 None
5eez X-ray 1.98 I 7-73 None
5eez X-ray 1.98 A 6-73 None
5eez X-ray 1.98 H 7-73 None
5eez X-ray 1.98 C 6-73 None
5eez X-ray 1.98 B 7-73 None
5eez X-ray 1.98 U 6-73 None
5eez X-ray 1.98 V 6-73 None
5eez X-ray 1.98 T 6-73 None
5eez X-ray 1.98 P 6-73 None
5eez X-ray 1.98 Q 6-73 None
5eez X-ray 1.98 S 6-73 None
5eez X-ray 1.98 R 6-73 None
5eez X-ray 1.98 N 6-73 None
5eez X-ray 1.98 O 6-73 None
5eez X-ray 1.98 M 6-73 None
5eez X-ray 1.98 L 6-73 None
1gtf X-ray 1.75 R 6-73 None
1gtf X-ray 1.75 S 6-73 None
1gtf X-ray 1.75 U 6-73 None
1gtf X-ray 1.75 V 6-73 None
1gtf X-ray 1.75 T 6-73 None
1gtf X-ray 1.75 N 6-73 None
1gtf X-ray 1.75 O 6-73 None
1gtf X-ray 1.75 Q 6-73 None
1gtf X-ray 1.75 P 6-73 None
1gtf X-ray 1.75 M 6-73 None
1gtf X-ray 1.75 L 6-73 None
1gtf X-ray 1.75 K 7-73 None
1gtf X-ray 1.75 J 7-73 None
1gtf X-ray 1.75 H 7-73 None
1gtf X-ray 1.75 I 7-73 None
1gtf X-ray 1.75 G 6-73 None
1gtf X-ray 1.75 F 7-73 None
1gtf X-ray 1.75 C 6-73 None
1gtf X-ray 1.75 D 7-73 None
1gtf X-ray 1.75 E 7-73 None
1gtf X-ray 1.75 B 7-73 None
1gtf X-ray 1.75 A 7-73 None
1gtn X-ray 2.5 K 7-73 None
1gtn X-ray 2.5 J 7-73 None
1gtn X-ray 2.5 G 6-73 None
1gtn X-ray 2.5 H 7-73 None
1gtn X-ray 2.5 I 7-73 None
1gtn X-ray 2.5 E 7-73 None
1gtn X-ray 2.5 F 7-73 None
1gtn X-ray 2.5 D 7-73 None
1gtn X-ray 2.5 C 6-73 None
1gtn X-ray 2.5 B 6-73 None
1gtn X-ray 2.5 A 7-73 None
1gtn X-ray 2.5 T 6-73 None
1gtn X-ray 2.5 U 6-73 None
1gtn X-ray 2.5 V 6-73 None
1gtn X-ray 2.5 S 6-73 None
1gtn X-ray 2.5 R 6-73 None
1gtn X-ray 2.5 Q 6-73 None
1gtn X-ray 2.5 O 6-73 None
1gtn X-ray 2.5 P 6-73 None
1gtn X-ray 2.5 N 6-73 None
1gtn X-ray 2.5 M 6-73 None
1gtn X-ray 2.5 L 6-73 None
5eew X-ray 1.98 J 7-73 None
5eew X-ray 1.98 H 7-73 None
5eew X-ray 1.98 I 7-73 None
5eew X-ray 1.98 K 7-73 None
5eew X-ray 1.98 A 6-73 None
5eew X-ray 1.98 B 7-73 None
5eew X-ray 1.98 C 6-73 None
5eew X-ray 1.98 D 7-73 None
5eew X-ray 1.98 E 7-73 None
5eew X-ray 1.98 F 7-73 None
5eew X-ray 1.98 G 7-73 None
5eew X-ray 1.98 U 6-73 None
5eew X-ray 1.98 V 6-73 None
5eew X-ray 1.98 S 6-73 None
5eew X-ray 1.98 T 6-73 None
5eew X-ray 1.98 Q 6-73 None
5eew X-ray 1.98 R 6-73 None
5eew X-ray 1.98 L 6-73 None
5eew X-ray 1.98 M 6-73 None
5eew X-ray 1.98 P 6-73 None
5eew X-ray 1.98 O 6-73 None
5eew X-ray 1.98 N 6-73 None
1utd X-ray 2.1 A 6-73 None
1utd X-ray 2.1 B 6-73 None
1utd X-ray 2.1 C 6-73 None
1utd X-ray 2.1 D 6-73 None
1utd X-ray 2.1 E 6-73 None
1utd X-ray 2.1 F 6-73 None
1utd X-ray 2.1 G 6-73 None
1utd X-ray 2.1 H 6-73 None
1utd X-ray 2.1 I 6-73 None
1utd X-ray 2.1 J 6-73 None
1utd X-ray 2.1 K 6-73 None
1utd X-ray 2.1 V 6-73 None
1utd X-ray 2.1 U 6-73 None
1utd X-ray 2.1 T 6-73 None
1utd X-ray 2.1 S 6-73 None
1utd X-ray 2.1 R 6-73 None
1utd X-ray 2.1 Q 6-73 None
1utd X-ray 2.1 P 6-73 None
1utd X-ray 2.1 O 6-73 None
1utd X-ray 2.1 N 6-73 None
1utd X-ray 2.1 L 6-73 None
1utd X-ray 2.1 M 6-73 None
5eev X-ray 1.98 H 7-73 None
5eev X-ray 1.98 G 7-73 None
5eev X-ray 1.98 I 7-73 None
5eev X-ray 1.98 K 7-73 None
5eev X-ray 1.98 J 7-73 None
5eev X-ray 1.98 F 7-73 None
5eev X-ray 1.98 E 7-73 None
5eev X-ray 1.98 D 7-73 None
5eev X-ray 1.98 C 6-73 None
5eev X-ray 1.98 B 7-73 None
5eev X-ray 1.98 A 6-73 None
5eev X-ray 1.98 U 6-73 None
5eev X-ray 1.98 V 6-73 None
5eev X-ray 1.98 Q 6-73 None
5eev X-ray 1.98 R 6-73 None
5eev X-ray 1.98 S 6-73 None
5eev X-ray 1.98 P 6-73 None
5eev X-ray 1.98 L 6-73 None
5eev X-ray 1.98 M 6-73 None
5eev X-ray 1.98 N 6-73 None
5eev X-ray 1.98 O 6-73 None
5eev X-ray 1.98 T 6-73 None
5ef1 X-ray 1.98 D 7-73 None
5ef1 X-ray 1.98 E 7-73 None
5ef1 X-ray 1.98 F 7-73 None
5ef1 X-ray 1.98 G 7-73 None
5ef1 X-ray 1.98 H 7-73 None
5ef1 X-ray 1.98 I 7-73 None
5ef1 X-ray 1.98 J 7-73 None
5ef1 X-ray 1.98 K 7-73 None
5ef1 X-ray 1.98 A 6-73 None
5ef1 X-ray 1.98 C 6-73 None
5ef1 X-ray 1.98 B 7-73 None
5ef1 X-ray 1.98 L 6-73 None
5ef1 X-ray 1.98 M 6-73 None
5ef1 X-ray 1.98 V 6-73 None
5ef1 X-ray 1.98 Q 6-73 None
5ef1 X-ray 1.98 R 6-73 None
5ef1 X-ray 1.98 S 6-73 None
5ef1 X-ray 1.98 T 6-73 None
5ef1 X-ray 1.98 U 6-73 None
5ef1 X-ray 1.98 P 6-73 None
5ef1 X-ray 1.98 O 6-73 None
5ef1 X-ray 1.98 N 6-73 None
5eex X-ray 1.98 I 7-73 None
5eex X-ray 1.98 J 7-73 None
5eex X-ray 1.98 K 7-73 None
5eex X-ray 1.98 A 6-73 None
5eex X-ray 1.98 B 7-73 None
5eex X-ray 1.98 C 6-73 None
5eex X-ray 1.98 D 7-73 None
5eex X-ray 1.98 E 7-73 None
5eex X-ray 1.98 H 7-73 None
5eex X-ray 1.98 G 7-73 None
5eex X-ray 1.98 F 7-73 None
5eex X-ray 1.98 V 6-73 None
5eex X-ray 1.98 U 6-73 None
5eex X-ray 1.98 T 6-73 None
5eex X-ray 1.98 R 6-73 None
5eex X-ray 1.98 S 6-73 None
5eex X-ray 1.98 Q 6-73 None
5eex X-ray 1.98 P 6-73 None
5eex X-ray 1.98 O 6-73 None
5eex X-ray 1.98 N 6-73 None
5eex X-ray 1.98 M 6-73 None
5eex X-ray 1.98 L 6-73 None
5ef2 X-ray 1.98 K 7-73 None
5ef2 X-ray 1.98 H 7-73 None
5ef2 X-ray 1.98 I 7-73 None
5ef2 X-ray 1.98 J 7-73 None
5ef2 X-ray 1.98 A 6-73 None
5ef2 X-ray 1.98 B 7-73 None
5ef2 X-ray 1.98 G 7-73 None
5ef2 X-ray 1.98 F 7-73 None
5ef2 X-ray 1.98 E 7-73 None
5ef2 X-ray 1.98 D 7-73 None
5ef2 X-ray 1.98 C 6-73 None
5ef2 X-ray 1.98 S 6-73 None
5ef2 X-ray 1.98 T 6-73 None
5ef2 X-ray 1.98 U 6-73 None
5ef2 X-ray 1.98 V 6-73 None
5ef2 X-ray 1.98 Q 6-73 None
5ef2 X-ray 1.98 R 6-73 None
5ef2 X-ray 1.98 O 6-73 None
5ef2 X-ray 1.98 P 6-73 None
5ef2 X-ray 1.98 L 6-73 None
5ef2 X-ray 1.98 M 6-73 None
5ef2 X-ray 1.98 N 6-73 None
5eey X-ray 1.98 K 7-73 None
5eey X-ray 1.98 F 7-73 None
5eey X-ray 1.98 G 7-73 None
5eey X-ray 1.98 B 7-73 None
5eey X-ray 1.98 C 6-73 None
5eey X-ray 1.98 J 7-73 None
5eey X-ray 1.98 I 7-73 None
5eey X-ray 1.98 H 7-73 None
5eey X-ray 1.98 D 7-73 None
5eey X-ray 1.98 E 7-73 None
5eey X-ray 1.98 A 6-73 None
5eey X-ray 1.98 R 6-73 None
5eey X-ray 1.98 S 6-73 None
5eey X-ray 1.98 T 6-73 None
5eey X-ray 1.98 U 6-73 None
5eey X-ray 1.98 V 6-73 None
5eey X-ray 1.98 M 6-73 None
5eey X-ray 1.98 N 6-73 None
5eey X-ray 1.98 O 6-73 None
5eey X-ray 1.98 Q 6-73 None
5eey X-ray 1.98 P 6-73 None
5eey X-ray 1.98 L 6-73 None
5ef3 X-ray 1.98 H 7-73 None
5ef3 X-ray 1.98 G 7-73 None
5ef3 X-ray 1.98 I 7-73 None
5ef3 X-ray 1.98 J 7-73 None
5ef3 X-ray 1.98 K 7-73 None
5ef3 X-ray 1.98 F 7-73 None
5ef3 X-ray 1.98 E 7-73 None
5ef3 X-ray 1.98 D 7-73 None
5ef3 X-ray 1.98 C 6-73 None
5ef3 X-ray 1.98 A 6-73 None
5ef3 X-ray 1.98 B 7-73 None
5ef3 X-ray 1.98 T 6-73 None
5ef3 X-ray 1.98 V 6-73 None
5ef3 X-ray 1.98 U 6-73 None
5ef3 X-ray 1.98 Q 6-73 None
5ef3 X-ray 1.98 R 6-73 None
5ef3 X-ray 1.98 S 6-73 None
5ef3 X-ray 1.98 P 6-73 None
5ef3 X-ray 1.98 O 6-73 None
5ef3 X-ray 1.98 N 6-73 None
5ef3 X-ray 1.98 M 6-73 None
5ef3 X-ray 1.98 L 6-73 None


© NPIDB team 2003 - 2019

text