Pfam domain
Pfam family: DNA_pol3_finger (PF17657.3)
Uniprot AC: Q9XDH5
RecName: DNA polymerase III subunit alpha
Begin-End: 624-792
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
TLTFLDEARRIVKESKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLK
PRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVSYAEFPHAEKYLRPILDETYGIPVY
QEQIMQIASQVAGYSLGEADLLRRAMGKKRVEEMQKHRERFVRGAKERG
Structures of the domain Q9XDH5 624-792
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e0d X-ray 4.6 B 624-792 None
3e0d X-ray 4.6 A 624-792  H-Bb 
4iqj X-ray 3.2 D 624-792 None
4iqj X-ray 3.2 C 624-792 None
4iqj X-ray 3.2 B 624-792 None
4iqj X-ray 3.2 A 624-792 None


© NPIDB team 2003 - 2021

text