Pfam domain
Pfam family: PHP (PF02811.21)
Uniprot AC: Q9XDH5
RecName: DNA polymerase III subunit alpha
Begin-End: 9-184
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
HLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKATAMGVKPI
IGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEKPRID
REILREHAQGLIALSGCLGAEIPQFILQDRLDLAEARLNEDLSIFGDRFFIEIQNH
Structures of the domain Q9XDH5 9-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e0d X-ray 4.6 B 9-184 None
3e0d X-ray 4.6 A 9-184 None
4iqj X-ray 3.2 B 9-184 None
4iqj X-ray 3.2 D 9-184 None
4iqj X-ray 3.2 A 9-184 None
4iqj X-ray 3.2 C 9-184 None


© NPIDB team 2003 - 2021

text