Pfam domain
Pfam family: BrkDBD (PF09607.9)
Uniprot AC: Q9XTN4
RecName: Brinker
Begin-End: 43-100
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCESNLRSSVAN
Structures of the domain Q9XTN4 43-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2glo NMR A 43-100  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text