Pfam domain
Pfam family: IMS (PF00817.19)
Uniprot AC: Q9Y253
RecName: DNA polymerase eta
Begin-End: 12-228
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKL
CPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQK
LQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLT
VGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACG
Structures of the domain Q9Y253 12-228
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaa X-ray 22 A 12-227 None
5kg1 X-ray 1.62 A 12-227 None
4ect X-ray 1.79 A 12-227 None
5kfu X-ray 1.55 A 12-227 None
4ecr X-ray 1.89 A 12-227 None
5l1j X-ray 1.94 A 12-227 None
5kg0 X-ray 1.6 A 12-227 None
4yr0 X-ray 1.78 A 11-226 None
3mr5 X-ray 1.8 A 12-227 None
5ewf X-ray 1.78 A 12-227 None
5kfv X-ray 1.6 A 12-227 None
5kfq X-ray 1.55 A 12-227 None
4o3n X-ray 1.58 A 12-227 None
4ed2 X-ray 1.71 A 12-227 None
5kfj X-ray 1.7 A 12-227 None
5l1k X-ray 1.82 A 12-227 None
4rnm X-ray 2.14 A 12-227 None
4o3s X-ray 1.72 A 12-227 None
4ed8 X-ray 1.52 A 12-227 None
5kfe X-ray 1.55 A 12-227 None
5kfa X-ray 1.51 A 12-227 None
3si8 X-ray 2.15 A 12-227 None
4rnn X-ray 1.81 A 12-227 None
4dl2 X-ray 2.15 A 12-227 None
4ed3 X-ray 1.79 A 12-227 None
5kfl X-ray 1.65 A 12-227 None
3mr2 X-ray 1.83 A 12-227 None
3tq1 X-ray 2.56 A 12-227 None
3mr3 X-ray 1.75 A 12-227 None
5kfb X-ray 1.55 A 12-227 None
3mr6 X-ray 1.9 A 12-227 None
4ecv X-ray 1.52 A 12-227 None
4ecy X-ray 1.94 A 12-227 None
4ed6 X-ray 2.21 A 12-227 None
4ecz X-ray 1.83 A 12-227 None
4ecq X-ray 1.5 A 12-227 None
4ecs X-ray 1.95 A 12-227 None
4ecx X-ray 1.74 A 12-227 None
4ecw X-ray 1.9 A 12-227 None
4ed1 X-ray 1.81 A 12-227 None
4ed0 X-ray 1.65 A 12-227 None
4ed7 X-ray 1.72 A 12-227 None
4ecu X-ray 1.95 A 12-227 None
5kfz X-ray 1.44 A 12-227 None
4dl6 X-ray 2.5 A 12-227 None
4j9p X-ray 2.3 A 12-227 None
4eey X-ray 2.32 A 12-227 None
4dl7 X-ray 1.97 A 12-227 None
4j9o X-ray 2.6 A 12-227 None
4j9l X-ray 1.85 A 12-227 None
4j9q X-ray 1.96 A 12-227 None
4dl3 X-ray 2.1 A 12-227 None
4dl4 X-ray 2 A 12-227 None
4j9s X-ray 1.95 A 12-227 None
4j9n X-ray 1.96 A 12-227 None
4j9k X-ray 2.03 A 12-227 None
4j9m X-ray 2.25 A 12-227 None
4j9r X-ray 2.35 A 12-227 None
5kfi X-ray 1.65 A 12-227 None
4o3p X-ray 1.72 A 12-227 None
4o3q X-ray 1.72 A 12-227 None
4o3o X-ray 1.7 A 12-227 None
4o3r X-ray 1.62 A 12-227 None
4q8f X-ray 2.8 A 12-227 None
5ewg X-ray 1.75 A 12-227 None
5kg5 X-ray 1.6 A 12-227 None
4dl5 X-ray 2.92 A 12-227 None
5kg6 X-ray 1.55 A 12-227 None
5l1i X-ray 2.78 A 12-227 None
4rno X-ray 2.82 A 12-227 None
5kfo X-ray 1.52 A 12-227 None
4ru9 X-ray 2.65 A 12-227 None
4yr3 X-ray 2 A 12-226 None
4yr2 X-ray 1.95 A 12-226 None
5kfr X-ray 1.75 A 12-227 None
5kfp X-ray 1.7 A 12-227 None
5kfd X-ray 1.65 A 12-227 None
5l9x X-ray 1.9 A 12-227 None
5kg3 X-ray 1.7 A 12-227 None
4yqw X-ray 2.06 A 12-227 None
5ewe X-ray 1.66 A 12-227 None
5kfm X-ray 1.6 A 12-227 None
5kfy X-ray 1.7 A 12-227 None
5kfh X-ray 1.72 A 12-227 None
5kfs X-ray 1.46 A 12-227 None
5kg4 X-ray 1.6 A 12-227 None
5kfx X-ray 1.52 A 12-227 None
4q8e X-ray 1.55 A 12-227 None
5kfn X-ray 1.45 A 12-227 None
5kg7 X-ray 1.75 A 12-227 None
4yp3 X-ray 1.89 A 12-227 None
5kft X-ray 1.52 A 12-227 None
5kff X-ray 1.7 A 12-227 None
5kfc X-ray 1.5 A 12-227 None
5kfk X-ray 1.7 A 12-227 None
5kfw X-ray 1.62 A 12-227 None
5l1l X-ray 1.62 A 12-227 None
5kfg X-ray 1.55 A 12-227 None
5kg2 X-ray 1.6 A 12-227 None


© NPIDB team 2003 - 2019

text