Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q9Y261
RecName: Hepatocyte nuclear factor 3-beta
Begin-End: 158-239
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCF
LKVPRSPDKPGKGSFWTLHPDS
Structures of the domain Q9Y261 158-239
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x07 X-ray 2.8 F 159-238  H-Bb H-Mj S-Bb L-Bb 
5x07 X-ray 2.8 C 159-237  H-Bb H-Mj S-Bb L-Bb L-Mn 
5x07 X-ray 2.8 I 159-237  H-Bb H-Mj S-Bb L-Bb 
5x07 X-ray 2.8 L 159-238  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text