Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9Y333
RecName: U6 snRNA-associated Sm-like protein LSm2
Begin-End: 5-72
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRG
SVVRYVQL
Structures of the domain Q9Y333 5-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 2 6-71 None
5o9z X-ray 4.5 o 8-73 None


© NPIDB team 2003 - 2019

text