Pfam domain
Pfam family: SBDS (PF01172.17)
Uniprot AC: Q9Y3A5
RecName: Ribosome maturation protein SBDS
Begin-End: 14-101
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLIS
AFGTDDQTEICKQILTKGEVQVSDKERH
Structures of the domain Q9Y3A5 14-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 J 14-101 None
5anc X-ray 4.2 J 14-101 None
5an9 X-ray 3.3 J 14-101 None


© NPIDB team 2003 - 2019

text