Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: Q9Y3B7
RecName: 39S ribosomal protein L11, mitochondrial
Begin-End: 18-78
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRT
F
Structures of the domain Q9Y3B7 18-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 J 26-84 None
5oom X-ray 3.03 J 20-78 None


© NPIDB team 2003 - 2019

text