Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9Y4Y9
RecName: U6 snRNA-associated Sm-like protein LSm5
Begin-End: 16-84
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLN
GNNITMLVP
Structures of the domain Q9Y4Y9 16-84
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 5 17-84 None
5o9z X-ray 4.5 r 17-84 None


© NPIDB team 2003 - 2019

text