Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q9Y4Z0
RecName: U6 snRNA-associated Sm-like protein LSm4
Begin-End: 5-71
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGS
TIKYLRI
Structures of the domain Q9Y4Z0 5-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 4 6-69 None
5o9z X-ray 4.5 q 13-76 None


© NPIDB team 2003 - 2019

text