Pfam domain
Pfam family: DNA_methylase (PF00145.19)
Uniprot AC: Q9Y6K1
RecName: DNA (cytosine-5)-methyltransferase 3A
Begin-End: 634-776
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
IRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQK
HIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFW
LFENVVAMGVSDKRDISRFLESN
Structures of the domain Q9Y6K1 634-776
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5yx2 X-ray 2.65 D 634-780  H-Bb L-Bb L-Mj L-Mn 
5yx2 X-ray 2.65 A 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8d X-ray 2.6 D 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8d X-ray 2.6 A 634-780  H-Bb L-Bb L-Mj L-Mn 
6pa7 X-ray 2.94 K 634-782  L-Bb 
6pa7 X-ray 2.94 P 634-782 None
6f57 X-ray 3.1 D 634-780  H-Bb L-Bb L-Mj L-Mn 
6f57 X-ray 3.1 A 634-780  L-Bb L-Mj L-Mn 
6brr X-ray 2.97 A 634-776  H-Bb L-Bb L-Mj L-Mn 
6brr X-ray 2.97 D 634-776  H-Bb L-Bb L-Mj L-Mn 
6w8j X-ray 2.45 D 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8j X-ray 2.45 A 634-780  L-Bb L-Mj L-Mn 
6w8b X-ray 2.4 A 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8b X-ray 2.4 D 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8b X-ray 2.4 K 634-780  H-Bb L-Bb L-Mj L-Mn 
6w8b X-ray 2.4 H 634-780  H-Bb L-Bb L-Mj L-Mn 
6w89 X-ray 2.5 A 634-780  H-Bb L-Bb L-Mj L-Mn 
6w89 X-ray 2.5 D 634-780  H-Bb L-Bb L-Mj L-Mn 
6w89 X-ray 2.5 J 634-780  H-Bb L-Bb L-Mj L-Mn 
6w89 X-ray 2.5 G 634-780  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text