Pfam domain
Pfam family: DNA_methylase (PF00145.16)
Uniprot AC: Q9Y6K1
RecName: DNA (cytosine-5)-methyltransferase 3A
Begin-End: 634-776
Organism: Homo sapiens
Interaction Mode:  L-Bb L-Mj L-Mn 

Sequence:
IRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQK
HIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFW
LFENVVAMGVSDKRDISRFLESN
Structures of the domain Q9Y6K1 634-776
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5yx2 X-ray 2.65 A 634-767  L-Bb L-Mj 
5yx2 X-ray 2.65 D 634-767  L-Bb L-Mj L-Mn 
6f57 X-ray 3.1 A 634-767 None
6f57 X-ray 3.1 D 634-767 None
6brr X-ray 2.97 A 634-767  L-Bb L-Mj 
6brr X-ray 2.97 D 634-767  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text