Pfam domain
Pfam family: DUF2258 (PF10015.8)
Uniprot AC: Q9YAS7
RecName: Uncharacterized protein
Begin-End: 4-81
Organism: Aeropyrum pernix
Interaction Mode:   

Sequence:
LRTGLVIAAGYADKVRRVLFAQLRDAIKSGELSNKDVAMAAGNLNRVLFELLVNKLKADK
LDVVRIQIDYEVRDSQIQ
Structures of the domain Q9YAS7 4-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pso X-ray 2.9 D 4-80 None
4pso X-ray 2.9 B 4-80 None
4pso X-ray 2.9 C 4-80 None
4pso X-ray 2.9 A 4-80 None
4pso X-ray 2.9 I 4-80 None
4pso X-ray 2.9 H 4-80 None
4pso X-ray 2.9 G 4-80 None
4pso X-ray 2.9 F 4-80 None


© NPIDB team 2003 - 2019

text